bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0858_orf2 Length=265 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL1P2.19 157 4e-37 > 5833.MAL1P2.19 Length=232 Score = 157 bits (396), Expect = 4e-37, Method: Compositional matrix adjust. Identities = 79/175 (45%), Positives = 111/175 (63%), Gaps = 6/175 (3%) Query 90 EWAVFPESNYSFEADSTLGNKWGSGSEEELLKKRQEAYFREGTRRSVAAIFLVHRAEYPH 149 EW ++P+SNY F D L NK+ E+ KKR AY + G R SV AI L HR EYPH Sbjct 25 EWLLYPQSNYEFNIDEKLKNKFIIDKEK--CKKRINAYNKNGIRNSVLAIILCHRYEYPH 82 Query 150 VLLLLDQQQKKHSLLMFKYKTWQKPREVLHAKLAEYLIRPEQCSKRKWVAQQLSNEGPD- 208 +LLL + +K+ LL KYKTW+KP+EVL KL +Y+ + + Q++ E + Sbjct 83 LLLLQHIESQKYYLLNGKYKTWEKPKEVLKKKLQKYI---NKIKDIHFTPAQINKEQEET 139 Query 209 MEVGEFLGEWWRGEFDDDLVPYLPPHVTRPKERVRVHQVQLPHRRSFRVPMGFCL 263 +E+G+FLGEWWR +F+ +PYLP H++RPKE +R++QV L + F +P GF L Sbjct 140 VEIGDFLGEWWRTQFNSVFLPYLPAHISRPKEYIRLYQVILSPKCIFHLPPGFTL 194 Lambda K H 0.318 0.134 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 83755957455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40