bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0939_orf2 Length=126 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G46960.1 62.0 5e-09 > 3702.AT3G46960.1 Length=1338 Score = 62.0 bits (149), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 11/86 (12%) Query 49 AAAAAAAAAAAVTGAA--------AAAPTDTASPSTAAADLSPEEEPLAIEFGFPLDDFQ 100 +A A + AVTG++ A D+ + +L P+ +AIEF F LD+FQ Sbjct 300 SAKTAIMSEEAVTGSSDKQLRKEGWATKGDSQDIADRFYELVPD---MAIEFPFELDNFQ 356 Query 101 KRAILRLEKNQCVFVAAHTSAGKTVV 126 K AI LEK + VFVAAHTSAGKTVV Sbjct 357 KEAICCLEKGESVFVAAHTSAGKTVV 382 Lambda K H 0.314 0.121 0.323 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40