bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1065_orf1 Length=146 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1370c 131 5e-30 > 5833.PFI1370c Length=353 Score = 131 bits (330), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 59/142 (41%), Positives = 91/142 (64%), Gaps = 1/142 (0%) Query 2 DFTQTVRRHMHGECLPVFRSFLAKFNDIFSVQERIILSGSWIGGGLHIAAVAACNVGNIR 61 +F +RRH+ GE PVF+ N++F + ER+ILSG W GG ++ AA++A NVGNI+ Sbjct 201 NFKYKIRRHISGEVFPVFQGMFKIINNLFDINERVILSGEWKGGHVYYAAISAYNVGNIK 260 Query 62 LEKEPDLRTNQDRVVLRHLGGDVDIRTYLDKPLHFGVGSHVGEFRLGSTIVLIFEAPQEF 121 + + DL TN R L ++GGD++ + Y D +G VGEF++GS+I++IFE + F Sbjct 261 IVNDEDLLTNNLRTQLSYMGGDINTKIY-DHYKDLEIGDEVGEFKVGSSIIVIFENKKNF 319 Query 122 EFSVAAGDKIRAGSRLGGVGPP 143 +++V +I G R+GGV P Sbjct 320 KWNVKPNQQISVGERIGGVDQP 341 Lambda K H 0.325 0.144 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40