bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1150_orf1 Length=224 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0245 218 1e-55 > 5833.PF11_0245 Length=555 Score = 218 bits (555), Expect = 1e-55, Method: Compositional matrix adjust. Identities = 114/228 (50%), Positives = 157/228 (68%), Gaps = 5/228 (2%) Query 1 LKEHVSRVGSSCYDKRGSWCKEEEPTLFELLNTLTPPPRKPDAPLRVPILDGYKDNGIIA 60 L EHVS S YD R SW +PTLF +LN+L PPP + PLR+P+L+GYKDNGIIA Sbjct 314 LSEHVSDKNSKIYDPRASWYDLSKPTLFNILNSLPPPPWDENGPLRIPLLEGYKDNGIIA 373 Query 61 LGKVEAGTVTYG--MTALLMPNKKRVKVTGVYIDEEEVSYASVGENVRIKLMGIEEDLLY 118 +GK+E+GT+ YG M LMPNK +VKV V+++++EV YA GENVR++L G+EED + Sbjct 374 IGKIESGTL-YGNNMNCTLMPNKVKVKVMNVFLEDDEVPYAKPGENVRVRLFGVEEDQIS 432 Query 119 NGSILSCIYTPCPIANKILAYIKVMDLLDHKPLLTAGYNCIMHVHTAREEVMLGKILESS 178 G +L C + ++ + + +++LL+HKP++TAGY CI H HTA EE+ ++LE Sbjct 433 KGFVLCDSINLCSVVHEFIGRVAIVELLEHKPIITAGYFCIFHAHTACEEIQFVEMLEVI 492 Query 179 D--GKKKKINPQFVTSDCLVSIEITLSKPMCMEEYEACSQLGRFTLRD 224 D KKKK P+F+ SDC+V+ LS P+C+E Y+ QLGRFTLRD Sbjct 493 DKKSKKKKTKPKFIKSDCIVTAHFLLSNPVCVEVYDNLPQLGRFTLRD 540 Lambda K H 0.318 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 61611077973 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40