bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1169_orf1 Length=123 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP011327-PA 96.7 2e-19 > 7165.AGAP011327-PA Length=356 Score = 96.7 bits (239), Expect = 2e-19, Method: Compositional matrix adjust. Identities = 41/86 (47%), Positives = 57/86 (66%), Gaps = 0/86 (0%) Query 38 VIDRLQGGRFRSLNEYLYTKKGSEAFVKYQKEPQLFDIYHTGYRAQVRRWPLNPLDCVAT 97 +++ L+G RFR +NE LY G EA +Q++P F+ YH GYR QV +WP+NPLD + Sbjct 143 LVESLKGSRFRFINEQLYKIPGQEAKKMFQEDPASFEAYHDGYRQQVEQWPMNPLDRMIK 202 Query 98 WLSKKPKEWVVGDFGCGEAALALRFP 123 + K PK+ ++ DFGCGEA LA P Sbjct 203 SILKMPKDTIIADFGCGEAKLAASVP 228 Lambda K H 0.320 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22834639773 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40