bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1204_orf2 Length=168 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00007400001 101 7e-21 > 99883.GSTENP00007400001 Length=1635 Score = 101 bits (252), Expect = 7e-21, Method: Composition-based stats. Identities = 50/108 (46%), Positives = 73/108 (67%), Gaps = 6/108 (5%) Query 3 DEKRQKRRETARQEALELLKRKQQNLPVDYKELMSKCSQSISITPAMVDKVIAACRELGI 62 ++ R++RR Q+ +LL+ + E ++S+SITPAM ++I A R G+ Sbjct 89 EKARRERRTANLQKGRQLLREGK------ISEARECFTRSVSITPAMAHRLIKAARARGV 142 Query 63 RCIVAPFEADAQLAYLSRTNQIHSAISEDSDLLAYGCKRVMLKMDKEG 110 CIVAP+EADAQLAYL++ + + I+EDSDLLA+GCK+V+LKMDK G Sbjct 143 DCIVAPYEADAQLAYLTKCHLAQAVITEDSDLLAFGCKKVILKMDKHG 190 Lambda K H 0.318 0.131 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30377245073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40