bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1220_orf2 Length=164 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G06110.1 149 2e-35 > 3702.AT5G06110.1 Length=663 Score = 149 bits (377), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 77/150 (51%), Positives = 109/150 (72%), Gaps = 4/150 (2%) Query 1 RRQYDSALPFDESVPSAADCQSPEDFYKIFGAAFQRNARWSVNRPVLTLGDCSTPLSAVE 60 RR +DS FD+ VP+ DC +P+DF+K+FG AF+RNARWS N P+ LGD +TPL V+ Sbjct 175 RRIFDSTDEFDDKVPT--DC-APQDFFKVFGPAFKRNARWS-NSPLPDLGDENTPLKEVD 230 Query 61 EFYEFWFAFESWRDFGVHDEHDLDQAACRLERRWMERENARIKKKYIKNERARIQKLVET 120 FY W+ F+SWR+F +EHD++QA R E+RWMERENAR +K K E ARI+ LV+ Sbjct 231 RFYSTWYTFKSWREFPEEEEHDIEQAESREEKRWMERENARKTQKARKEEYARIRTLVDN 290 Query 121 AHAADPRIKQRKEEERKKKEEEKAAQLRAR 150 A+ D RI++RK++E+ KK ++K A++ A+ Sbjct 291 AYKKDIRIQKRKDDEKAKKLQKKEAKVMAK 320 Lambda K H 0.318 0.130 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28631644438 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40