bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1267_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_2160 115 3e-25 > 5807.cgd7_2160 Length=462 Score = 115 bits (289), Expect = 3e-25, Method: Composition-based stats. Identities = 56/142 (39%), Positives = 85/142 (59%), Gaps = 4/142 (2%) Query 1 NPYHAFYKLKVREFTTGEAAPT--PQVPQAIRDMQQKQQQQKQKQQQLLMLTQIDESEKD 58 NP+H +YK ++ +F G + P +P+AI DM ++++Q ++++LMLT Sbjct 54 NPFHLYYKKRIEDFKNGVSIDNSGPTIPRAILDMNSRKEKQIIAEKEVLMLTSFSGGFGF 113 Query 59 GVKEKLEPPPP--NQFVLQHPWVAPVDLDIIRCCAQFVARNGQKFLAGLAQREQQNPQFA 116 +EP P +Q+ + HP ++ D +I+ A ++ARNGQ FL+ L RE NPQF Sbjct 114 MGGAVMEPEEPRKDQYTISHPIISIKDESVIKITAMYLARNGQSFLSDLTARESNNPQFD 173 Query 117 FLKPSHHLFSYFASLVDAYTKC 138 FLKP H LF YFA LV+AY+ C Sbjct 174 FLKPGHALFGYFADLVEAYSLC 195 Lambda K H 0.320 0.134 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40