bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1345_orf1 Length=143 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0186544 90.1 2e-17 > 44689.DDBDRAFT_0186544 Length=299 Score = 90.1 bits (222), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 43/95 (45%), Positives = 66/95 (69%), Gaps = 4/95 (4%) Query 34 MARNAERANAVLNKWLAVKNAVIKGAKKNIQLGPCIPEECDDLDRATQWRQQLIREIGRG 93 MARN E+A ++LN++L +K K ++ P + ECD L A +WR+Q+++EI RG Sbjct 1 MARNEEKAKSMLNRYLQLKGTESKQEERR----PYLSNECDSLVDAEKWRRQILKEITRG 56 Query 94 ISLIQDSSLGDHRIRDLNDQINKKIKQKKRWEFRI 128 I+ IQ+S+L +++IRDLND INK +++K WE RI Sbjct 57 ITEIQNSALDEYKIRDLNDHINKLVREKGHWERRI 91 Lambda K H 0.318 0.128 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40