bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1366_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G56070.1 167 1e-40 > 3702.AT1G56070.1 Length=843 Score = 167 bits (422), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 72/119 (60%), Positives = 96/119 (80%), Gaps = 0/119 (0%) Query 1 DAIHRGAGQIMPTCRRVLYAAQLVSQPRLQEPMFLVDISVPRDSMEGIDTVLFVRRGHVF 60 DAIHRG GQ++PT RRV+YA+Q+ ++PRL EP+++V+I P ++ GI +VL +RGHVF Sbjct 697 DAIHRGGGQVIPTARRVIYASQITAKPRLLEPVYMVEIQAPEGALGGIYSVLNQKRGHVF 756 Query 61 EEDSKPGNPLVVLRAYLPVAESFGFTTALRAATSGQAFPQCVFDHWSCLNGDPLEKGSK 119 EE +PG PL ++AYLPV ESFGF++ LRAATSGQAFPQCVFDHW ++ DPLE G++ Sbjct 757 EEMQRPGTPLYNIKAYLPVVESFGFSSQLRAATSGQAFPQCVFDHWEMMSSDPLEPGTQ 815 Lambda K H 0.323 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40