bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1379_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_2220 75.1 6e-13 > 5807.cgd1_2220 Length=213 Score = 75.1 bits (183), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 49/154 (31%), Positives = 76/154 (49%), Gaps = 28/154 (18%) Query 3 MGLKTDSLKDHKKEINEIIDKIVEEL------------------NGDGEEEESEEEEDGD 44 +GL DSLK K +IN++ID I+ E+ N D ++EE+ + D Sbjct 48 LGLPLDSLKPKKNQINDLIDAIILEIKEKNSTDSPIEQITNNVSNVDYKDEETNA--NND 105 Query 45 ESYDDEESEQPSKKQKTGNGPPKNLKKLQSTMMAKSTFLEKAPVLASKIGDV--QFEMKP 102 E ++D P ++ G K + M+ FLEK+ L+ I + + P Sbjct 106 EEHNDLNINIPEITKQNGKA-----TKRKQISMSIEEFLEKSQTLSLSINGSSEKLAISP 160 Query 103 RTFSSGSCGWFHGSKVAIKVGDQ-EIWCQLGVNC 135 R FS+GS GW++G KV + VGD E+ CQ+ +NC Sbjct 161 RQFSTGSVGWYYGGKVPLPVGDDLEVLCQISINC 194 Lambda K H 0.306 0.128 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40