bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1494_orf1 Length=146 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_3770 88.6 4e-17 > 5807.cgd4_3770 Length=1040 Score = 88.6 bits (218), Expect = 4e-17, Method: Composition-based stats. Identities = 39/96 (40%), Positives = 68/96 (70%), Gaps = 0/96 (0%) Query 30 EEIQQISASILTSFVERLDDDLMKSLQSIDVHSDEYKERLGKSIDILALLWRTFCFLDER 89 +E + + + L SF+ERLD + +K+LQ DVHS EYK+RL +S+ +LALLWR + +ER Sbjct 472 KEQDKSTVTFLVSFIERLDGESLKALQLTDVHSSEYKDRLVQSLHLLALLWRCYKICEER 531 Query 90 GFKTQAATVALKVNEHMHYKPDNIAIKMWDVLRKEL 125 G+ +++++ + +H+K D++AIK+W+ +R+ L Sbjct 532 GYYDLVSSLSVHLINQLHFKNDSLAIKVWEFVRQIL 567 Lambda K H 0.315 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40