bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1499_orf2 Length=66 Score E Sequences producing significant alignments: (Bits) Value 76114.ebA1413 70.5 1e-11 > 76114.ebA1413 Length=354 Score = 70.5 bits (171), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 37/65 (56%), Positives = 42/65 (64%), Gaps = 0/65 (0%) Query 2 ALVQLSASHTPREGSWLRFDGDLLVEVLGRHGEFLRVRFDSEVPVLDLLEEHGQLPLPPY 61 AL Q+ AS +PR GS LR V VLGR GEF +RF VLDLLE HG+LPLPPY Sbjct 100 ALAQVRASKSPRAGSRLRLADAFDVTVLGRVGEFFHLRFPDSHDVLDLLEHHGKLPLPPY 159 Query 62 IEREG 66 I+R Sbjct 160 IDRSA 164 Lambda K H 0.321 0.144 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22990495724 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40