bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1517_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_1590 100 1e-20 > 5807.cgd6_1590 Length=1184 Score = 100 bits (249), Expect = 1e-20, Method: Composition-based stats. Identities = 45/120 (37%), Positives = 70/120 (58%), Gaps = 12/120 (10%) Query 1 YEFELNYKKTMTGNMIFVGELLKSKMISQAILLECIDRLLQKRAECIAASNSKDQGIHHV 60 +E++L YK M GNMIF+ L++ K+I+ ++L C++ LLQ HH+ Sbjct 808 FEWQLKYKNKMKGNMIFMASLVRKKVIASTVVLMCMEELLQFHLP------------HHL 855 Query 61 EALCAFLHTVGPFFDNPQWRLYGEFCRRMDLVASLASDSSLPFRVRCLMSDVLDSRAAGW 120 EALC FLH VGPF D+ +W+ Y +F +++ +P R+R L++DV+DSR W Sbjct 856 EALCVFLHHVGPFLDSERWKHYEDFNTLFLQFEEFSTNKEVPIRIRFLINDVIDSRKNNW 915 Lambda K H 0.326 0.137 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40