bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1526_orf1 Length=126 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0201744 68.9 4e-11 > 44689.DDBDRAFT_0201744 Length=805 Score = 68.9 bits (167), Expect = 4e-11, Method: Composition-based stats. Identities = 43/117 (36%), Positives = 64/117 (54%), Gaps = 10/117 (8%) Query 3 LSQQQGADWAKKRLKAGVTYARRKQLDQAIQLYDSALQLKPDYADAFIARGAAYANKLGY 62 L Q WA+ +K G+ YA+ Q ++AI Y AL + D+ DA++A GA YAN + Sbjct 468 LRSNQNFIWAQSSVKNGIKYAKSGQYEKAINYYKEALNIDRDHKDAYVALGAVYANTSQF 527 Query 63 EKAMADLDAALALEPHNKNAAKY--KSIVKDRMEGKE--------RPASKERSSSST 109 EKA+++ AL ++P++ NA KY ++VK + G P SK SSST Sbjct 528 EKAISNFKQALKIDPNDVNADKYFKATLVKMKDSGYSVEDCLKFIGPTSKPFDSSST 584 Lambda K H 0.312 0.126 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40