bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1574_orf1 Length=136 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0095c 117 1e-25 > 5833.PFL0095c Length=207 Score = 117 bits (293), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 57/102 (55%), Positives = 72/102 (70%), Gaps = 1/102 (0%) Query 25 APRKKGQAEGNAEEEENLLP-NDARKYFKQGQKFITPPNGDGTRGFYESLYEENKNSLVA 83 P K G E + E E N NDARKYFK+GQK ITPPNGDGTR FYESL EEN NS++A Sbjct 80 TPTKDGFGELDVEGENNSNEINDARKYFKEGQKIITPPNGDGTRAFYESLLEENPNSIIA 139 Query 84 LRYLVEWGVLTGTLLHESLPRYFALKEKGAFKGAGGGLQKAF 125 ++Y +E G+L+GT HE+L +Y+ LK+ AFK GG++ F Sbjct 140 IKYCIEHGILSGTKHHEALYKYYVLKKNNAFKSNFGGVRIDF 181 Lambda K H 0.310 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22513421946 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40