bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1610_orf1 Length=147 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G33840.1 218 6e-56 > 3702.AT2G33840.1 Length=385 Score = 218 bits (554), Expect = 6e-56, Method: Compositional matrix adjust. Identities = 100/145 (68%), Positives = 122/145 (84%), Gaps = 2/145 (1%) Query 1 AKANSISRVKRCSQIMGRAEGDDQPSAQIMYPCMQCADIFYLNADICQLGMDQRKVNVLA 60 A+ N + R+ RC QIMGR+E D+ +AQI+YPCMQCADIF+L ADICQLGMDQRKVNVLA Sbjct 170 ARKNKLPRILRCVQIMGRSETDELSAAQILYPCMQCADIFFLEADICQLGMDQRKVNVLA 229 Query 61 REYCDYIKKKNKQVILSHHMLPGLLEGQDKMSKSNTDSAIFMEDSEAEVNRKIKKAFCPP 120 REYCD IK+KNK +ILSHHMLPGL +GQ+KMSKS+ SAIFMED EAEVN KIKKA+CPP Sbjct 230 REYCDDIKRKNKPIILSHHMLPGLQQGQEKMSKSDPLSAIFMEDEEAEVNVKIKKAYCPP 289 Query 121 CIIEGNPCISYAEYLVYP--DEYLV 143 +++GNPC+ Y +Y++ P DE+ V Sbjct 290 KVVKGNPCLEYIKYIILPWFDEFTV 314 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23033159460 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40