bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1774_orf1 Length=133 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_840 165 3e-40 > 5807.cgd6_840 Length=408 Score = 165 bits (418), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 72/116 (62%), Positives = 95/116 (81%), Gaps = 0/116 (0%) Query 14 LWLLTKHWALHNILAIAFCIQAIALVSVGSFGVASILLCGLFVYDVIWVFGTEVMVSVAK 73 +W++T W +HN+ AIAFCIQAI+L+S+GSF + +ILLCGLFVYD+ WVFGT+VMV+VAK Sbjct 187 IWIITDSWIIHNLFAIAFCIQAISLISIGSFKIGAILLCGLFVYDIFWVFGTDVMVTVAK 246 Query 74 AFEGPAKLMFPVQISPLQYSILGLGDVVIPGVLIAMCLRFDLFLYLKQQNATAQQL 129 +F+GPAKL+FPV P + SILGLGD+VIPG+ I++CLRFDL Y K+ N + L Sbjct 247 SFQGPAKLIFPVSFDPWKQSILGLGDIVIPGLFISLCLRFDLKDYTKKHNQSLYHL 302 Lambda K H 0.333 0.143 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22766716098 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40