bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1819_orf2 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_4090 77.0 1e-13 > 5807.cgd4_4090 Length=1063 Score = 77.0 bits (188), Expect = 1e-13, Method: Composition-based stats. Identities = 42/90 (46%), Positives = 58/90 (64%), Gaps = 1/90 (1%) Query 43 DKQGNIISIERPGMLDVNGLFSAVSEEEFLEWHSDILEFRSMLLDVLSRKFNRMVRVTAV 102 D GNII IER G+LD L AV EE L W+S +E+RS+LLD LS + ++R T + Sbjct 193 DYYGNIICIERFGLLDETRLLGAVKVEELLLWYSYHMEYRSILLDKLSYESKSLIRATCI 252 Query 103 IDLQGLS-TRILNRRALNLLRRTISSASEN 131 IDL GLS +++ + + +LRR I AS+N Sbjct 253 IDLFGLSISQVHSSHMITILRRMIQLASDN 282 Lambda K H 0.318 0.133 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40