bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1903_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_2340 70.9 1e-11 > 5807.cgd2_2340 Length=1652 Score = 70.9 bits (172), Expect = 1e-11, Method: Composition-based stats. Identities = 37/108 (34%), Positives = 65/108 (60%), Gaps = 2/108 (1%) Query 2 RVLNDHGITKERLASYERKITMEPHMVQ-TDINELVNDFKAYLSVIQDVHDARDARKAFD 60 ++L++ G++ E++ SY+R IT +P++ D+N L +DF+ YL V+ DVH+A + +++F Sbjct 823 KILHEEGLSWEKIRSYDRPITSKPYIPPFLDVNTLASDFEQYLEVLVDVHEASNLQRSFH 882 Query 61 YARGYLAGDTIQIVERVVWEMGQRTDNM-GAGELHNRFARLSEARRLI 107 Y+R YL + I V++ +R DN LH R ++ AR I Sbjct 883 YSREYLDERSQNICASVIFGENKRFDNTKDLNVLHGRLMHVNRAREEI 930 Lambda K H 0.323 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40