bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1968_orf1 Length=85 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0354 100 1e-20 > 5833.PF13_0354 Length=1408 Score = 100 bits (249), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 44/79 (55%), Positives = 58/79 (73%), Gaps = 0/79 (0%) Query 2 MQFNRENAQTLTPLPAPCVDTGTVLERLVSVLQNKKSNYDTDLFQPIFERIHSFNTKLPK 61 MQ+N++ + + LP PC+DTG LER+ S+LQN SNYDTDLFQPIF++I LP Sbjct 604 MQYNKDENKNMNKLPFPCIDTGMGLERITSILQNVDSNYDTDLFQPIFKQIKELFPYLPN 663 Query 62 YQGKVGEEDKNKIDTAYRA 80 Y+GK+ E+D +KIDTAYR Sbjct 664 YEGKINEQDVDKIDTAYRV 682 Lambda K H 0.317 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22515314785 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40