bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1991_orf1 Length=177 Score E Sequences producing significant alignments: (Bits) Value 246197.MXAN_4527 85.5 7e-16 > 246197.MXAN_4527 Length=5182 Score = 85.5 bits (210), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 53/179 (29%), Positives = 86/179 (48%), Gaps = 19/179 (10%) Query 1 IQWGPWNDVGMVTRNEKLERVFRSRGIKPFTPEEGIQIMELALQTEEPCVCALNVNWKKY 60 I WGPW +VGM +L ++++G++ FTP E ++ A +P + L V W +Y Sbjct 4955 INWGPWAEVGMAA---ELASRYQAQGVEAFTPAEALEAFGKAFSRAQPQLTLLQVQWSRY 5011 Query 61 FQAFDHNI---------------PRALAERVSETQTSSENSRDKGRSKELIEAVVLEAAR 105 F P A SE + + + + R L+E V+ A R Sbjct 5012 LAQFPRGAAPTLLADVAGQVRAEPEADGPSASELRRRLDTAEPRQRMALLLEHVLDAAVR 5071 Query 106 SL-VDKDEVISTGTRLDELGLDSLGSVELRNLLQERLAMSLPASLLLEYATLGEVIEYI 163 L +D + RL E+G+DSL ++ELRN LQ+ + SLP++L+ +Y T + Y+ Sbjct 5072 VLGLDASTPLEPRQRLFEVGMDSLMALELRNRLQKTVGASLPSTLVFDYPTAEAIAAYL 5130 Lambda K H 0.315 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35195248557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40