bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2003_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G47770.1 85.5 5e-16 > 3702.AT3G47770.1 Length=900 Score = 85.5 bits (210), Expect = 5e-16, Method: Composition-based stats. Identities = 41/95 (43%), Positives = 55/95 (57%), Gaps = 0/95 (0%) Query 37 PTKALKGVSFCVPRGSCFAYIGINGSGKSTTFNILGSLMPQSAGSVFVGGFDILQQTRKA 96 P A+ G+S VP G CF +G NG+GK++ N++ L+ S+GS FV G DI + K Sbjct 601 PKLAVCGLSLAVPSGECFGMLGPNGAGKTSFINMMTGLVKPSSGSAFVQGLDICKDMDKV 660 Query 97 RAKLRYCPQTDALLPTLTGAEHVYLYGCLLGLRRH 131 + CPQ D L TLTG EH+ YG L L+ H Sbjct 661 YISMGVCPQHDLLWETLTGKEHLLFYGRLKNLKGH 695 Lambda K H 0.328 0.144 0.478 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40