bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2024_orf2 Length=162 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0217694 157 8e-38 > 44689.DDBDRAFT_0217694 Length=428 Score = 157 bits (398), Expect = 8e-38, Method: Compositional matrix adjust. Identities = 83/163 (50%), Positives = 104/163 (63%), Gaps = 8/163 (4%) Query 1 SASLVQAIRGLSL-SRSPLNSPHLFWDTQPVVKASEQKSLTTQDEGPIDATKTVEDVKKE 59 S LV+ + SL S+ P H FWDTQPV K ++ + GPI+ KT++DV+K+ Sbjct 27 SKRLVELFKASSLASKKP--KGHEFWDTQPVPKIDDK----IIESGPIE-NKTLDDVRKD 79 Query 60 PYNLPNGFVWSECSVEDPQVLDELYNLLALHYVEDDDNLFRFNYGKDFLVWALNPPNFFK 119 P LP F W E P+ L E+Y LL +YVEDDDN+FRF+Y +FL WAL PP F K Sbjct 80 PLTLPPAFEWIELDCNKPEELKEIYTLLYENYVEDDDNMFRFDYSPEFLKWALQPPGFLK 139 Query 120 EWIIGVRVEASQKLVGFISAIPTTLMCNSKRIRVAEVNFLCVH 162 EW IGVRV S+KLVGFIS IP T+ K I + E+NFLCVH Sbjct 140 EWHIGVRVVESKKLVGFISGIPATIRVEGKPITMVEINFLCVH 182 Lambda K H 0.319 0.135 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 27386790332 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40