bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2034_orf1 Length=125 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000034618 124 1e-27 > 9031.ENSGALP00000034618 Length=262 Score = 124 bits (310), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 58/123 (47%), Positives = 81/123 (65%), Gaps = 0/123 (0%) Query 1 PPLGIASFDPKGIPFLNTVPLVSSGVSVTWTHHAIEQGDYRARIISLFLTILLGATFTSF 60 PP G+ +P +P LNT L++SGV+VTW HH+I +G+ + I +L LTILLG FT+ Sbjct 117 PPTGVKPLNPLEVPLLNTAILLASGVTVTWAHHSITEGNRKQAIHALTLTILLGFYFTAL 176 Query 61 QLLEYYVAGFTFSCSAYSSVYFIGTGFHGLHVLIGRVLLFICLIRFSFLVISPNHSVGFE 120 Q +EY+ A F+ + S Y S +F+ TGFHGLHV+IG L +CL+R +PNH GFE Sbjct 177 QAMEYHEASFSIADSVYGSTFFVATGFHGLHVIIGSSFLTVCLLRLIKFHFTPNHHFGFE 236 Query 121 CSC 123 + Sbjct 237 AAA 239 Lambda K H 0.331 0.146 0.468 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22670743557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40