bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2100_orf2 Length=76 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.150 95.9 3e-19 > 5833.MAL8P1.150 Length=2245 Score = 95.9 bits (237), Expect = 3e-19, Method: Composition-based stats. Identities = 41/76 (53%), Positives = 58/76 (76%), Gaps = 0/76 (0%) Query 1 GMKMFGLDAGIGITSGRVWCGTVGNDLRKEYTALGDFVNLAARLMAKAGPREIYVDANTH 60 +K L+ IGI++G++WCG +GN +RKEYTALGD VN+AARL KAG +EIYVD NT+ Sbjct 695 ALKSLKLNGSIGISTGKIWCGIIGNKIRKEYTALGDSVNVAARLCFKAGNKEIYVDENTY 754 Query 61 RSAQHAMEFKQLPSMK 76 + +H + F++L S+K Sbjct 755 NNCKHFISFQKLISIK 770 Lambda K H 0.321 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23163449821 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40