bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2196_orf1 Length=143 Score E Sequences producing significant alignments: (Bits) Value 4896.SPBC1347.07 134 1e-30 > 4896.SPBC1347.07 Length=180 Score = 134 bits (336), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 64/124 (51%), Positives = 87/124 (70%), Gaps = 0/124 (0%) Query 1 KKELEEMGSWCREHHGKSGLTQACLRSCMTASDAEQRIIAFLKLNGVGAKEAVLAGNSVH 60 +K+L EM WC E HGKSGLT+ C +S +T D E +++A++K +EA++AGNSVH Sbjct 52 EKQLSEMNDWCIEQHGKSGLTERCRQSNLTVKDVENQLLAYIKKYIPKKREALIAGNSVH 111 Query 61 MDKEFLRREMPELIEFLHYRILDISSIKVVAKSWFPRVAPPKKRYRHRALADIQESIEEL 120 D FL EMP++IE LHYRI+D+S+IK +AK W P + K+ HRAL+DI ESI EL Sbjct 112 ADVRFLSVEMPKIIEHLHYRIIDVSTIKELAKRWCPDIPAYDKKGDHRALSDILESIGEL 171 Query 121 AYYR 124 +YR Sbjct 172 QHYR 175 Lambda K H 0.320 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40