bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2257_orf2 Length=178 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.134 230 2e-59 > 5833.MAL8P1.134 Length=1870 Score = 230 bits (586), Expect = 2e-59, Method: Composition-based stats. Identities = 105/192 (54%), Positives = 137/192 (71%), Gaps = 14/192 (7%) Query 1 GSTTYPIHKVPKEWKKAPVWSMLHSKQYPRCKAKVLVAFELVPAELVENDTYPFFDDIRP 60 GS T+PI KVP EWKK+P+W L S QY +CKAK+LVAFELVP E V +DTYPF+DDIRP Sbjct 751 GSCTFPIMKVPTEWKKSPIWIPLKSSQYKKCKAKLLVAFELVPVEKVLDDTYPFYDDIRP 810 Query 61 STKQATVSIFLVGVRLFSPVQKPYVEVCFGRDVEDTTKPLWSERTSEPHVGEGGNWNFLQ 120 ST VS+FL+G+R+F P++ P V VCFGRDV+DT++ LW E T++ G+ GNWNFL+ Sbjct 811 STLPGHVSLFLIGIRMFKPLKDPSVTVCFGRDVDDTSQFLWHETTNKVISGKEGNWNFLK 870 Query 121 HFNVSVSLPKRMQHHCFMEVKVHDEV--EGISGKTMTE------------VGMAYITLNP 166 +F++ V LPKRMQHH F+EV++ D + G +G + +G AYITLNP Sbjct 871 YFSLDVMLPKRMQHHSFLEVRIEDRILNSGFTGTASSNMHAVNATNNNLLIGTAYITLNP 930 Query 167 LLPWLEQREREE 178 LLPWL+ E+ E Sbjct 931 LLPWLDNYEKNE 942 Lambda K H 0.319 0.135 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35812709058 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40