bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2277_orf1 Length=159 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL001200-PA 104 8e-22 > 7159.AAEL001200-PA Length=600 Score = 104 bits (260), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 1/114 (0%) Query 41 ECDVNRFTYRSHCCGQVDDSLVGEEVTLCGWIEYHRFCKFLTLRDSYGSVQLFVKSSELQ 100 +C VN+FT R+H CG++ S V +E+ +CGW+E+ R KF TLRD YGS Q+F+ Sbjct 7 DCSVNKFTNRTHNCGELRTSHVDQEIVICGWLEFSRLNKFFTLRDGYGSTQIFIPDELAA 66 Query 101 EI-VRNLSLESVIKDKGKVNYRPDKDVNSKLVNGNVEVSVEELSVLNMCKANLP 153 E+ + N+ ES+++ +GKV RP N +L G VEV + + VLN + LP Sbjct 67 EVNLNNIPFESILRVEGKVVKRPKGQENPRLPTGEVEVVLGNVEVLNKARNRLP 120 Lambda K H 0.318 0.131 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26246233818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40