bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2280_orf1 Length=137 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000013049 77.4 1e-13 > 7719.ENSCINP00000013049 Length=1134 Score = 77.4 bits (189), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 5/136 (3%) Query 5 VCTKPNISDNKLIVLNNAEKRCEMCQNIVNNLQQ---VQSHDLELDQLTENSCSKLPKAH 61 VC+ + N V+ + + C++C+ + L Q S E++ +N C KLP + Sbjct 999 VCSSLKLCSNSNKVMFKSSELCDVCKAAIGFLDQEVGANSTKAEVEAALDNLCVKLPASL 1058 Query 62 RTECGLMMKAFAPYFFDMMNHQDNAKEICKSIDICMTPGHVHLLGGHKCTFGPSYWCHTV 121 + C ++K + P DM+ + + IC + +C H+LG + CTFGPSYWC Sbjct 1059 KETCDDLVKQYTPEILDMIENIADPDYICIHLKLCT--AQNHMLGANPCTFGPSYWCKNQ 1116 Query 122 DHAHACNAATYCRQKV 137 A CNA ++C + V Sbjct 1117 QTATECNAVSHCEKHV 1132 Lambda K H 0.323 0.133 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22428990562 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40