bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2325_orf1 Length=130 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0227 162 2e-39 > 5833.PF13_0227 Length=247 Score = 162 bits (411), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 0/117 (0%) Query 2 IKRPAVFVTAAYDNVAGVRLPVFQITTDPTVDILKNINLSAGGHVILAARDKYQEALAEL 61 IKRP V ++ + +NVAGV+LP+FQ+ DPTVD+L N+ ++AGG VI R+ Y + L L Sbjct 87 IKRPVVTLSLSTNNVAGVKLPIFQVNIDPTVDVLGNLGVAAGGQVINNTRENYLQCLNML 146 Query 62 VKLASLQTAFFTLDAEIKMTNRRVNALNNVVLPKLDRSITYITKELDEMEREEFFRL 118 VKLAS+Q AFF+LD EIKMTNRRVNALNN+VLP+LD I YI KELDE+EREEF+RL Sbjct 147 VKLASMQVAFFSLDEEIKMTNRRVNALNNIVLPRLDGGINYIIKELDEIEREEFYRL 203 Lambda K H 0.320 0.135 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40