bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2419_orf1 Length=112 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_3020 79.7 2e-14 > 5807.cgd3_3020 Length=357 Score = 79.7 bits (195), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 34/73 (46%), Positives = 52/73 (71%), Gaps = 0/73 (0%) Query 40 QEIIHPAVIRVGLQMANRKIQGANARTVAMLSSFNCFIEDYSPPPYESIDRHIKLSLDRR 99 Q IHPA++R+G++M +RKI G N R+ +L + +EDY PPY+SI++H+K+ LD Sbjct 34 QSKIHPAILRLGMRMKDRKIVGTNMRSKCLLIAIGQMLEDYYCPPYKSIEKHLKMVLDVH 93 Query 100 INFITNCRPHNFA 112 I++IT+ R HN A Sbjct 94 ISYITSQRQHNIA 106 Lambda K H 0.320 0.129 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40