bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2460_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value 3702.AT4G22310.1 120 9e-27 > 3702.AT4G22310.1 Length=108 Score = 120 bits (302), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 61/81 (75%), Positives = 63/81 (77%), Gaps = 1/81 (1%) Query 46 HPAGPFTIHFWAPTFKWGISIANIIDMIDKDVSGVSPAQQTAVAATGIIWSRYSMVITPK 105 HPAGP TIHFWAPTFKWGISIANI D K +S QQ AV TG+IWSRYSMVI PK Sbjct 12 HPAGPKTIHFWAPTFKWGISIANIADFA-KPPEKLSYPQQIAVTCTGVIWSRYSMVINPK 70 Query 106 NWNLFSVNVAMALTGCVQLAR 126 NWNLFSVNVAMA TG QLAR Sbjct 71 NWNLFSVNVAMAGTGIYQLAR 91 Lambda K H 0.320 0.129 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40