bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2466_orf1 Length=104 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb927.8.770 71.2 8e-12 > 5691.Tb927.8.770 Length=639 Score = 71.2 bits (173), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 2/92 (2%) Query 1 IVELRGEPFLREENRRVAVVVNCGERFLLPLLPRPREGSTEQENGVFWRTSARPYQ-DLP 59 I ELRG+P LR NR +A+++ G RFLLPL+P RE E+GV+W+ RPY+ L Sbjct 116 ITELRGDPRLRRGNRLIALIITEGRRFLLPLIPERREDDDSPESGVYWQVPTRPYEVQLS 175 Query 60 PS-FAELLVGTVQDPERASNIVQNLPSSSAEF 90 S A+L++GT+Q E +++V+ S ++ Sbjct 176 QSPRAQLVIGTLQHVEEVNDMVRRFAESGSQH 207 Lambda K H 0.318 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22759408663 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40