bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2542_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0508 129 2e-29 > 5833.PF14_0508 Length=1192 Score = 129 bits (325), Expect = 2e-29, Method: Composition-based stats. Identities = 54/102 (52%), Positives = 78/102 (76%), Gaps = 0/102 (0%) Query 1 RAQRELIANTIKHCDVVICTAAIHGKPSPKLISRDMLRTMKPGSVIVDLATEFGDVRAGW 60 + Q L IK CD++IC+A+I GK SPKL++ +M++ MKPGSV VDL+TEFGD + W Sbjct 880 KVQSNLFKKIIKKCDILICSASIPGKTSPKLVTTEMIKLMKPGSVAVDLSTEFGDKKNNW 939 Query 61 GGNVEVAPKDDQIVVDGITVIGRRRIETRMPVQASELFSMNM 102 GGN+E + ++ I+++G+ V+GR +IE MP+QAS+LFSMNM Sbjct 940 GGNIECSQSNENILINGVHVLGRDKIERNMPMQASDLFSMNM 981 Lambda K H 0.327 0.139 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40