bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2656_orf2 Length=107 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0295c 73.2 2e-12 > 5833.PFL0295c Length=1082 Score = 73.2 bits (178), Expect = 2e-12, Method: Composition-based stats. Identities = 30/56 (53%), Positives = 42/56 (75%), Gaps = 0/56 (0%) Query 52 FPNPRCDLHALKWEPHVLKALGGMVIKMVSQDFAVSASKFYLQYTVLGGLTFALFW 107 FPN CDL+ LKWE H+LK LG ++ M+SQ+FA++AS+ +LQYT+ L+ AL W Sbjct 862 FPNCYCDLYCLKWENHLLKTLGSLIETMLSQEFAITASRIWLQYTIASTLSAALTW 917 Lambda K H 0.327 0.139 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40