bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2667_orf1 Length=109 Score E Sequences producing significant alignments: (Bits) Value 3702.AT4G24450.1 108 4e-23 > 3702.AT4G24450.1 Length=1278 Score = 108 bits (270), Expect = 4e-23, Method: Composition-based stats. Identities = 54/109 (49%), Positives = 75/109 (68%), Gaps = 1/109 (0%) Query 1 PRVIAFPSKSVALTCKQCLIFRSDSNGEDLEGFAGAGLFESIPAERAFWLPLCYWRQRLV 60 P VI++PSK + L K +IFRSDSN EDLEG AGAGL++S+ + A + + Y R+ L+ Sbjct 1171 PTVISYPSKRIGLYSKPSIIFRSDSNNEDLEGNAGAGLYDSVIMDEAEEVVVDYSREPLI 1230 Query 61 SDRLYRDALLSKISKVGRLVEEVYGAPQDIEGVVIGDDTVALVQTRPQV 109 D+ +R L S I++ G ++E +YG PQDIEGVV G + +VQ RPQV Sbjct 1231 MDKSFRVRLFSAIAEAGNVIESIYGCPQDIEGVVKGGH-IYIVQARPQV 1278 Lambda K H 0.323 0.140 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22374500883 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40