bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2755_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 13616.ENSMODP00000004387 95.5 4e-19 > 13616.ENSMODP00000004387 Length=517 Score = 95.5 bits (236), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 56/122 (45%), Positives = 71/122 (58%), Gaps = 11/122 (9%) Query 1 SDKAAVEITSRYSGKIVKLYAQEGETVKVGGPLVDIDSPDVEDTQAQQSSAPPSSDSEHA 60 SDKA+V ITSRY G I KLY +T VG PLVDI++ ++D++ P EH Sbjct 85 SDKASVTITSRYDGIIRKLYYALEDTAFVGKPLVDIETESLKDSEEDVVETPAVFHDEHT 144 Query 61 AISQQQEQTTAAPSSKGGEALASPAVRRLAKEKGVDLDKVKGTGARGAITKDDILNYLSS 120 QE KG + LA+PAVRRLA E + L +V GTG G I K+DILNYL+ Sbjct 145 ----HQE-------IKGHKTLATPAVRRLAMENNIKLSEVVGTGKDGRILKEDILNYLAK 193 Query 121 ET 122 +T Sbjct 194 QT 195 Lambda K H 0.300 0.119 0.308 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40