bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2818_orf1 Length=105 Score E Sequences producing significant alignments: (Bits) Value 5833.PF08_0045 156 1e-37 > 5833.PF08_0045 Length=1038 Score = 156 bits (395), Expect = 1e-37, Method: Composition-based stats. Identities = 67/105 (63%), Positives = 87/105 (82%), Gaps = 0/105 (0%) Query 1 RAQLFENFCATKFSTTRRFGLDGCETLIVGMKAITKRAVASGLESVVIGMAHRGRLNVLV 60 RA +FEN+ A KF+TT+RFG+DGCETLI GMKA+ KRA ++SV++ M+HRGRLNVL Sbjct 260 RAFIFENYMAAKFATTKRFGVDGCETLITGMKALIKRAAQLDVDSVLMSMSHRGRLNVLF 319 Query 61 NVLHKPMQQILSEFQGVSGYGGSEWGNTGDVKYHLGVEFDLFDRD 105 NVLHKP++Q++SEF+G +G+ + WGNTGDVKYHLGVE D +D D Sbjct 320 NVLHKPLEQMMSEFRGKTGFSDNIWGNTGDVKYHLGVEIDYYDED 364 Lambda K H 0.323 0.140 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682427107 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40