bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2857_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value 205921.SAK_1488 77.8 9e-14 > 205921.SAK_1488 Length=291 Score = 77.8 bits (190), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 40/114 (35%), Positives = 68/114 (59%), Gaps = 7/114 (6%) Query 5 GPAVARNVGLDHATGD--YITFIDAADYVKENYLEWLVTECQAATAEIAISDYYRYKEQT 62 G + ARN GL + + ++TF+D+ D+VKENYLE L+ + + A+I IS+YY Y+E Sbjct 70 GASKARNFGLARISSESQFVTFVDSDDWVKENYLEVLLAQQEKYNADIVISNYYIYRETE 129 Query 63 NMLYSYRAKKDYQVVDLALAELLQRK-----NKLEFTTVWGKLFQRTLFERVRF 111 ++ Y KD+ + +++ + R+ N F +WGKL++R LF+ + F Sbjct 130 DIFGYYITDKDFVIEEISAQTAIDRQVHWHLNSSVFIVIWGKLYRRELFDTITF 183 Lambda K H 0.321 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22619469984 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40