bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2863_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 4959.DEHA0C00660g 74.7 7e-13 > 4959.DEHA0C00660g Length=670 Score = 74.7 bits (182), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 2/131 (1%) Query 23 CYGRFLAEYRVLAASVTSKTPADGP-WLVGKCGQLNLLNLYIFLQLFVETVEDYKAASTQ 81 C G + LA S+ S P W + +LL + + A +T+ Sbjct 90 CQGDNVVTATSLATSICSSAGVPSPFWFIPASASADLLEA-AEATITDDVTSSSAAETTE 148 Query 82 PSSTEPASTQPSSTQPSSTQPSSTQPSSTEPASTEPSSTQPSSTEPASTEPSSTEPASTE 141 P+S+ PA+++P S +P+S++P S +P+S+EP S EP+S++P S EPAS+EP S EPAS+E Sbjct 149 PASSAPATSEPVSFEPASSEPVSFEPASSEPVSFEPASSEPVSFEPASSEPVSFEPASSE 208 Query 142 PASTEPASTEP 152 PAS EPAS+EP Sbjct 209 PASFEPASSEP 219 Lambda K H 0.303 0.119 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40