bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2875_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value 4959.DEHA0F14773g 101 5e-21 > 4959.DEHA0F14773g Length=232 Score = 101 bits (252), Expect = 5e-21, Method: Compositional matrix adjust. Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 0/83 (0%) Query 33 IDLLLIMTVEPEFGGQTFLYEQMNKVKKARQLFPYLNIQVDGGLNAETVQVAAESGANVI 92 +D+ L+MTVEP FGGQ F+ E M KV+ RQ FP LNIQVDGGL ET+ AAE+GANVI Sbjct 138 LDMALVMTVEPGFGGQKFMPEMMPKVESLRQKFPELNIQVDGGLGHETIPAAAEAGANVI 197 Query 93 VAGTSLYNCPSPGTLMEYMRDVI 115 VAGT+++ P +++ +R+ + Sbjct 198 VAGTAVFKAQDPKEMIQLLRNAV 220 Lambda K H 0.320 0.133 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40