bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2896_orf1 Length=165 Score E Sequences producing significant alignments: (Bits) Value 5478.CAGL0E01947g 112 6e-24 > 5478.CAGL0E01947g Length=452 Score = 112 bits (279), Expect = 6e-24, Method: Compositional matrix adjust. Identities = 68/178 (38%), Positives = 99/178 (55%), Gaps = 31/178 (17%) Query 1 GRSRGFGFVTFEEMETINNVVDRHHTIDESQVEVRRAIPREEARNNQPRRERETTENSGR 60 GRSRGFGF+TFE +++ VV H +D ++ +RAIPREE + +G+ Sbjct 160 GRSRGFGFLTFESASSVDEVVKTQHILDGKVIDPKRAIPREEQ------------DKTGK 207 Query 61 VFIGGLGDDVTDEVLKEFFSRFGELTSASVMVDRETNRPRGFGFIIYKNPEDAEKALGIH 120 +F+GG+G DV + +EFF+++G + A +M+D++T R RGFGFI Y P DA + + Sbjct 208 IFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTP-DAVDKVCQN 266 Query 121 KDL---GPNAEAKRAQPR-----------SQTSRMRMFGMG-GMPMAG---GYRFEDP 160 K + G E KRA PR +Q S +GMG G +G GY F+DP Sbjct 267 KFIDFKGRKIEIKRAAPRHLQKTGGARQPAQQSSNSQYGMGTGSNSSGQYPGYGFQDP 324 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 29254071491 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40