bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2910_orf1 Length=176 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P7.43 113 3e-24 > 5833.MAL3P7.43 Length=693 Score = 113 bits (282), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 66/169 (39%), Positives = 104/169 (61%), Gaps = 8/169 (4%) Query 13 SSSSKKQREETEEGEVVENVPKEDEEEEEEEGDSE----PEFMAEQPIGDSVSGALQYLQ 68 +SS+K EE ++++N E+EE+ ++ SE E E + + + GAL+YL+ Sbjct 525 NSSNKNILEENINEDILKNTFLENEEDHNDDNSSELHGVSEIFNEVKLDEGLFGALEYLK 584 Query 69 SKDFFSL-DKIRRRRGHHLEQPLHNADNDKEVNIDYRDAFGNVMTAKDAFRRISWHFHGK 127 +K ++ DKI R + +PLH + + ++ +DY++ FG VMT K++FR ISW FHGK Sbjct 585 TKGELNMEDKIYRNPEN---KPLHMSTDKDDIKLDYKNEFGKVMTPKESFRYISWIFHGK 641 Query 128 FPSLRKQEKKIKKLELERRLQENIMDCLPTLKALKKVQEGESSAHLVLT 176 K EKKIK+LE+ERR +EN +D LPTL LKK Q+ + ++ L+ Sbjct 642 KQGKNKLEKKIKRLEIERRYKENPIDSLPTLNVLKKYQQTQKKSYFTLS 690 Lambda K H 0.308 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35336795289 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40