bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2927_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0070 138 6e-32 > 5833.PF13_0070 Length=429 Score = 138 bits (347), Expect = 6e-32, Method: Composition-based stats. Identities = 61/122 (50%), Positives = 93/122 (76%), Gaps = 0/122 (0%) Query 1 VRDQYAGDGIAIRGISYGIQTIRIDGNDLFASFLATKQARQLILDTNEPVLMEFMTYRVG 60 ++DQY GDGIA R ++ GI++IR+DGNDLFAS+LATK+ R + + ++PV +EFM+YR G Sbjct 257 IKDQYRGDGIAPRALALGIESIRVDGNDLFASYLATKKLRDICIQESKPVFIEFMSYRYG 316 Query 61 QHSTSDDSSAYRPPGELEAWNASGILPIARLRKYLAHEGWWTDEEEEELRKESRKYMLEQ 120 HSTSDDSS YRP E EAW G+ PI+R+ YL ++ ++++E++E RK ++ +L++ Sbjct 317 HHSTSDDSSLYRPKEENEAWRQEGVHPISRIFLYLKNKNLYSEKEDQEHRKSVKENVLKE 376 Query 121 MK 122 +K Sbjct 377 LK 378 Lambda K H 0.317 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40