bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2934_orf1 Length=153 Score E Sequences producing significant alignments: (Bits) Value 351348.Maqu_1467 63.5 2e-09 > 351348.Maqu_1467 Length=413 Score = 63.5 bits (153), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 46/161 (28%), Positives = 77/161 (47%), Gaps = 21/161 (13%) Query 5 GKPCKEVKLAVRSIRGGVSGATLSSALNIMGH--------KCMQSPFYLIEYAVDQPNNN 56 GKPC++V++ V+ +GG+SG T++S +N+ K + +PF + P + Sbjct 167 GKPCQDVRMRVKVAKGGLSGGTVASMINVAKEAGADPKLRKELANPFSIC-----PPEHR 221 Query 57 IQQLPTQPRVCALHRDSDF-GYSTFYVMSRVNENVVRWTNALLNYRYGYDFKYYEMLSCN 115 ++ QP + + D +F + +VM +N VV +NAL RYG +F Y E + Sbjct 222 SEK--RQPSLKSAEFDKNFDAWLAPFVMGAINTRVVHRSNALQGARYGKEFTYDEAIMTG 279 Query 116 FNLISCL--FIMLCTYTALFTFSCTF-TRYICNLLHIIPSP 153 L + M+ A FT S TR++ L +P P Sbjct 280 KGTKGRLTAYGMVGALGAFFTASAIKPTRWVVEKL--VPKP 318 Lambda K H 0.327 0.139 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23213563385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40