bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2977_orf1 Length=87 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1360w 86.7 2e-16 > 5833.PFF1360w Length=173 Score = 86.7 bits (213), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 39/87 (44%), Positives = 58/87 (66%), Gaps = 1/87 (1%) Query 1 HGHNYSAAAKLFGQLNLHDGYVIDFSQAKTALRDVCKTLNEHLIVPMRSDVLEITQEGSS 60 HGHNY+ + K+ G + DGYVIDFS K ++ VC L+ H I+P+ SDVL+ ++ Sbjct 41 HGHNYNVSLKVRGYVR-DDGYVIDFSILKEKVKKVCNKLDHHFILPIYSDVLKFENVKNN 99 Query 61 IRMRCEDGAEFLIPRQDCLCLPIVHST 87 I++ CED +E+ P +DC+ LPI HS+ Sbjct 100 IKIICEDNSEYSFPERDCIKLPIKHSS 126 Lambda K H 0.324 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22371284777 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40