bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2997_orf2 Length=167 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_2330 92.8 4e-18 > 5807.cgd8_2330 Length=1143 Score = 92.8 bits (229), Expect = 4e-18, Method: Composition-based stats. Identities = 49/115 (42%), Positives = 74/115 (64%), Gaps = 1/115 (0%) Query 51 GLAAVMVGFANFHSP-AGVERASSLLRLLEVYAGVFVAGITFTGSVVAAAKLHGSMESRS 109 GLAA+++ FAN +P E S + +E++ G ++ ITFTGS+VAA KLH S + Sbjct 181 GLAAMLISFANLWTPFQSSEEEFSAVHAIEMFIGEAISAITFTGSIVAAGKLHEIFPSGA 240 Query 110 LRVPGRHALNSATIAAIGVLGALFCVSSGHLTRMLCLYVNAGLSMWLGFHLVAAI 164 L++PGRH LN+ +A + LG++F + + + R +Y N+ LSM LG HLVA+I Sbjct 241 LKLPGRHFLNALMVAGLIALGSVFIIITDYANRTYLMYGNSLLSMLLGIHLVASI 295 Lambda K H 0.324 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30498925597 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40