bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3006_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000008454 114 6e-25 > 9031.ENSGALP00000008454 Length=571 Score = 114 bits (286), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 0/94 (0%) Query 2 QEWCGFGWDSQLLETGFLGAWISPFWSSSRFPRSWPVPFVCIWGCRWLLLRLYLGTGLSL 61 Q W FGW+SQLLETGFLG ++ P W+ SR PRS P + IWG RWL+ R+ LG GL Sbjct 172 QIWYSFGWESQLLETGFLGMFLCPLWTLSRLPRSTPPSSIVIWGFRWLIFRIMLGAGLIK 231 Query 62 LRGDSAWRDLSALSYYYQTQPLPSPLAWVLHHQP 95 +R D WRDL+ ++Y+Y+TQP+P+P+A+ +H P Sbjct 232 IREDHCWRDLTCMNYHYETQPVPNPIAYFMHRSP 265 Lambda K H 0.328 0.141 0.535 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40