bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3054_orf1 Length=126 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0925c 154 5e-37 > 5833.PFE0925c Length=1123 Score = 154 bits (390), Expect = 5e-37, Method: Compositional matrix adjust. Identities = 77/112 (68%), Positives = 90/112 (80%), Gaps = 1/112 (0%) Query 3 KEASLLADLKLLNLPEQELRAKQQEKELEQIRMHYLGMKKEKKKIQKPSEKFRNIFNFEW 62 K S LA+L +LNL + R +EKELE I+ YLG+ K KKKIQKPSEKFRNIFNFEW Sbjct 427 KPESSLAELNMLNLSNIQ-RDNLKEKELEIIKQQYLGLNKTKKKIQKPSEKFRNIFNFEW 485 Query 63 DASEDTMRGDNNPLYQNRIEPQLLFGRGFRAGMDIREQRKANNFYDELVKRR 114 D SEDT R D+NPLYQNR+EPQLLFGRG+ AG+D+REQRK NNFYD+LV+ R Sbjct 486 DQSEDTSRNDSNPLYQNRLEPQLLFGRGYIAGIDVREQRKKNNFYDKLVQNR 537 Lambda K H 0.317 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40